ALS (IGFALS) (NM_004970) Human Mass Spec Standard

SKU
PH306542
IGFALS MS Standard C13 and N15-labeled recombinant protein (NP_004961)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206542]
Predicted MW 66.1 kDa
Protein Sequence
Protein Sequence
>RC206542 protein sequence
Red=Cloning site Green=Tags(s)

MALRKGGLALALLLLSWVALGPRSLEGADPGTPGEAEGPACPAACVCSYDDDADELSVFCSSRNLTRLPD
GVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALG
TFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQ
PALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAG
LLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQL
QEVKAGAFLGLTNMAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDN
GLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVS
HNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDCGCPLKALRDFALQNPSAVPR
FVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAPC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004961
RefSeq Size 2168
RefSeq ORF 1815
Synonyms ACLSD; ALS
Locus ID 3483
UniProt ID P35858
Cytogenetics 16p13.3
Summary The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in this gene are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:ALS (IGFALS) (NM_004970) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401546 IGFALS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401546 Transient overexpression lysate of insulin-like growth factor binding protein, acid labile subunit (IGFALS), transcript variant 2 100 ug
$436.00
TP306542 Recombinant protein of human insulin-like growth factor binding protein, acid labile subunit (IGFALS), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.