Glycerol 3 Phosphate Dehydrogenase (GPD1) (NM_005276) Human Mass Spec Standard

SKU
PH306538
GPD1 MS Standard C13 and N15-labeled recombinant protein (NP_005267)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206538]
Predicted MW 37.6 kDa
Protein Sequence
Protein Sequence
>RC206538 protein sequence
Red=Cloning site Green=Tags(s)

MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLP
PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERL
GIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVG
AGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFART
GKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005267
RefSeq Size 3083
RefSeq ORF 1047
Synonyms GPD-C; GPDH-C; HTGTI
Locus ID 2819
UniProt ID P21695
Cytogenetics 12q13.12
Summary This gene encodes a member of the NAD-dependent glycerol-3-phosphate dehydrogenase family. The encoded protein plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of dihydroxyacetone phosphate (DHAP) and reduced nicotine adenine dinucleotide (NADH) to glycerol-3-phosphate (G3P) and NAD+. The encoded cytosolic protein and mitochondrial glycerol-3-phosphate dehydrogenase also form a glycerol phosphate shuttle that facilitates the transfer of reducing equivalents from the cytosol to mitochondria. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]
Protein Pathways Glycerophospholipid metabolism
Write Your Own Review
You're reviewing:Glycerol 3 Phosphate Dehydrogenase (GPD1) (NM_005276) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417409 GPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417409 Transient overexpression lysate of glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1) 100 ug
$436.00
TP306538 Recombinant protein of human glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720715 Purified recombinant protein of Human glycerol-3-phosphate dehydrogenase 1 (soluble) (GPD1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.