NSP3 (SH2D3C) (NM_005489) Human Mass Spec Standard

SKU
PH306537
SH2D3C MS Standard C13 and N15-labeled recombinant protein (NP_005480)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206537]
Predicted MW 77.1 kDa
Protein Sequence
Protein Sequence
>RC206537 protein sequence
Red=Cloning site Green=Tags(s)

MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPR
EVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALV
RYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSVTMTDGLT
ADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLHSPMSPISESPSSPAYSTVTRVHAAPAAPSATAL
PASPVARRSSEPQLCPGSAPKTHGESDKGPHTSPSHTLGKASPSPSLSSYSDPDSGHYCQLQPPVRGSRE
WAATETSSQQARSYGERLKELSENGAPEGDWGKTFTVPIVEVTSSFNPATFQSLLIPRDNRPLEVGLLRK
VKELLAEVDARTLARHVTKVDCLVARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIML
AVDILGCTGSAEERAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQISRLEQTWVTLRQRHTEGAIL
YEKKLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPPEGPEPWGSTEHGVEVVLAHLEAARTVA
HHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSSQARRYEKFDKVLTALSHKLEPAVRS
SEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005480
RefSeq Size 2692
RefSeq ORF 2109
Synonyms CHAT; NSP3; PRO34088; SHEP1
Locus ID 10044
UniProt ID Q8N5H7
Cytogenetics 9q34.11
Summary This gene encodes an adaptor protein and member of a cytoplasmic protein family involved in cell migration. The encoded protein contains a putative Src homology 2 (SH2) domain and guanine nucleotide exchange factor-like domain which allows this signaling protein to form a complex with scaffolding protein Crk-associated substrate. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:NSP3 (SH2D3C) (NM_005489) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406911 SH2D3C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417274 SH2D3C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406911 Transient overexpression lysate of SH2 domain containing 3C (SH2D3C), transcript variant 1 100 ug
$436.00
LY417274 Transient overexpression lysate of SH2 domain containing 3C (SH2D3C), transcript variant 2 100 ug
$436.00
TP306537 Recombinant protein of human SH2 domain containing 3C (SH2D3C), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.