ALKBH1 (NM_006020) Human Mass Spec Standard

SKU
PH306529
ALKBH1 MS Standard C13 and N15-labeled recombinant protein (NP_006011)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206529]
Predicted MW 43.9 kDa
Protein Sequence
Protein Sequence
>RC206529 protein sequence
Red=Cloning site Green=Tags(s)

MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS
SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET
QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE
DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG
FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD
QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006011
RefSeq Size 2585
RefSeq ORF 1167
Synonyms ABH; ABH1; alkB; ALKBH; hABH
Locus ID 8846
UniProt ID Q13686
Cytogenetics 14q24.3
Summary This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ALKBH1 (NM_006020) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401825 ALKBH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401825 Transient overexpression lysate of alkB, alkylation repair homolog 1 (E. coli) (ALKBH1) 100 ug
$436.00
TP306529 Recombinant protein of human alkB, alkylation repair homolog 1 (E. coli) (ALKBH1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.