OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMAD2 (NM_001003652) Human Mass Spec Standard

Be the first to review this product
SKU
PH306526
SMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_001003652)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501728 SMAD2 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10) 100 ul
$447.00
LY400372 Transient overexpression lysate of SMAD family member 2 (SMAD2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SMAD2 or NM_001003652"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206526
Predicted MW 52.3 kDa
Protein Sequence
Protein Sequence
>RC206526 protein sequence
Red=Cloning site Green=Tags(s)

MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNC
NTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH
HELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
ELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECL
SDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001003652
RefSeq Size 10551
RefSeq ORF 1401
Synonyms hMAD-2; hSMAD2; JV18; JV18-1; MADH2; MADR2
Locus ID 4087
UniProt ID Q15796
Cytogenetics 18q21.1
Summary The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene. provided by RefSeq, May 2012
Protein Families Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors
Protein Pathways Adherens junction, Cell cycle, Colorectal cancer, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SMAD2" proteins (9)
SKU Description Size Price
PH304604 SMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_005892) 10 ug
$3,360.00
LC400372 Lyophilized SMAD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC401783 Lyophilized SMAD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427736 Lyophilized SMAD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400372 Transient overexpression lysate of SMAD family member 2 (SMAD2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY401783 Transient overexpression lysate of SMAD family member 2 (SMAD2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427736 Transient overexpression lysate of SMAD family member 2 (SMAD2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP304604 Recombinant protein of human SMAD family member 2 (SMAD2), transcript variant 1, 20 µg 20 ug
$737.00
TP306526 Recombinant protein of human SMAD family member 2 (SMAD2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products