OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HBZ (NM_005332) Human Mass Spec Standard

Be the first to review this product
SKU
PH306504
HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370712 HBZ rabbit polyclonal antibody
100 ul
$310.00
LY417379 Transient overexpression lysate of hemoglobin, zeta (HBZ) (as WB positive control) 100 ug
$436.00

Other products for "HBZ or NM_005332"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206504
Predicted MW 15.6 kDa
Protein Sequence
Protein Sequence
>RC206504 protein sequence
Red=Cloning site Green=Tags(s)

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA
VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK
YR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005323
RefSeq Size 589
RefSeq ORF 426
Synonyms HBAZ; HBZ-T1; HBZ1
Locus ID 3050
UniProt ID P02008
Cytogenetics 16p13.3
Summary Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. provided by RefSeq, Nov 2009
Protein Families Embryonic stem cells, ES Cell Differentiation/IPS
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HBZ" proteins (4)
SKU Description Size Price
LC417379 Lyophilized HBZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417379 Transient overexpression lysate of hemoglobin, zeta (HBZ) (as WB positive control) 100 ug
$436.00
TP306504 Recombinant protein of human hemoglobin, zeta (HBZ), 20 µg 20 ug
$867.00
TP720205 Recombinant protein of human hemoglobin, zeta (HBZ) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products