REG1 beta (REG1B) (NM_006507) Human Mass Spec Standard

SKU
PH306451
REG1B MS Standard C13 and N15-labeled recombinant protein (NP_006498)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206451]
Predicted MW 18.7 kDa
Protein Sequence
Protein Sequence
>RC206451 protein sequence
Red=Cloning site Green=Tags(s)

MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSG
NLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASL
TSCSGFKKWKDESCEKKFSFVCKFKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006498
RefSeq Size 812
RefSeq ORF 498
Synonyms PSPS2; REGH; REGI-BETA; REGL
Locus ID 5968
UniProt ID P48304
Cytogenetics 2p12
Summary This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV based on the primary structures of the encoded proteins. This gene encodes a protein secreted by the exocrine pancreas that is highly similar to the REG1A protein. The related REG1A protein is associated with islet cell regeneration and diabetogenesis, and may be involved in pancreatic lithogenesis. Reg family members REG1A, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:REG1 beta (REG1B) (NM_006507) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416596 REG1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416596 Transient overexpression lysate of regenerating islet-derived 1 beta (REG1B) 100 ug
$436.00
TP306451 Recombinant protein of human regenerating islet-derived 1 beta (REG1B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.