MYL7 (NM_021223) Human Mass Spec Standard

SKU
PH306449
MYL7 MS Standard C13 and N15-labeled recombinant protein (NP_067046)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206449]
Predicted MW 19.4 kDa
Protein Sequence
Protein Sequence
>RC206449 protein sequence
Red=Cloning site Green=Tags(s)

MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVP
EEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSP
AEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067046
RefSeq Size 619
RefSeq ORF 525
Synonyms MYL2A; MYLC2A
Locus ID 58498
UniProt ID Q01449
Cytogenetics 7p13
Protein Families Druggable Genome
Protein Pathways Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction
Write Your Own Review
You're reviewing:MYL7 (NM_021223) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412006 MYL7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412006 Transient overexpression lysate of myosin, light chain 7, regulatory (MYL7) 100 ug
$436.00
TP306449 Recombinant protein of human myosin, light chain 7, regulatory (MYL7), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.