Alpha 2 Antiplasmin (SERPINF2) (NM_000934) Human Mass Spec Standard

SKU
PH306435
SERPINF2 MS Standard C13 and N15-labeled recombinant protein (NP_000925)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206435]
Predicted MW 54.6 kDa
Protein Sequence
Protein Sequence
>RC206435 protein sequence
Red=Cloning site Green=Tags(s)

MVLLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQTALKSPPGVC
SRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHLALGAQNHTLQRLQQVLHAGS
GPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLEQSEQLFGAKPVSLTGKQEDDLANINQWVKE
ATEGKIQEFLSGLPEDTVLLLLNAIHFQGFWRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLL
EQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVAT
LSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSP
K

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000925
RefSeq Size 2284
RefSeq ORF 1473
Synonyms A2AP; AAP; ALPHA-2-PI; alpha2AP; API; PLI
Locus ID 5345
UniProt ID P08697
Cytogenetics 17p13.3
Summary This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Complement and coagulation cascades
Write Your Own Review
You're reviewing:Alpha 2 Antiplasmin (SERPINF2) (NM_000934) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424449 SERPINF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431370 SERPINF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424449 Transient overexpression lysate of serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 1 100 ug
$436.00
LY431370 Transient overexpression lysate of serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 3 100 ug
$436.00
TP306435 Recombinant protein of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP328342 Recombinant protein of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701066 Purified recombinant protein of Human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00
TP762699 Purified recombinant protein of Human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2 (SERPINF2), transcript variant 1, Asn40-End, with C-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.