OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JMJD5 (KDM8) (NM_024773) Human Mass Spec Standard

Be the first to review this product
SKU
PH306417
JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_079049)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810968 JMJD5 mouse monoclonal antibody,clone OTI5D11 100 ul
$447.00
LY403027 Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "JMJD5 or NM_024773"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206417
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC206417 protein sequence
Red=Cloning site Green=Tags(s)

MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV
ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK
VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG
VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD
QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY
PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079049
RefSeq Size 2481
RefSeq ORF 1248
Synonyms JMJD5
Locus ID 79831
UniProt ID Q8N371
Cytogenetics 16p12.1
Summary This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.provided by RefSeq, Feb 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JMJD5" proteins (7)
SKU Description Size Price
PH327709 JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_001138820) 10 ug
$3,360.00
LC403027 Lyophilized KDM8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428835 Lyophilized KDM8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403027 Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428835 Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306417 Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 2, 20 µg 20 ug
$737.00
TP327709 Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products