JMJD5 (KDM8) (NM_024773) Human Mass Spec Standard

SKU
PH306417
JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_079049)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206417]
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC206417 protein sequence
Red=Cloning site Green=Tags(s)

MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV
ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK
VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG
VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD
QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY
PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079049
RefSeq Size 2481
RefSeq ORF 1248
Synonyms JMJD5
Locus ID 79831
UniProt ID Q8N371
Cytogenetics 16p12.1
Summary This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:JMJD5 (KDM8) (NM_024773) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327709 JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_001138820) 10 ug
$3,255.00
LC403027 KDM8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428835 KDM8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403027 Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 2 100 ug
$436.00
LY428835 Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 1 100 ug
$436.00
TP306417 Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 2, 20 µg 20 ug
$737.00
TP327709 Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.