Bcl G (BCL2L14) (NM_138722) Human Mass Spec Standard

SKU
PH306404
BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620048)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206404]
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC206404 protein sequence
Red=Cloning site Green=Tags(s)

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV
SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC
LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA
KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA
KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620048
RefSeq Size 1886
RefSeq ORF 981
Synonyms BCLG
Locus ID 79370
UniProt ID Q9BZR8
Cytogenetics 12p13.2
Summary The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq, May 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Bcl G (BCL2L14) (NM_138722) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315213 BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620049) 10 ug
$3,255.00
LC408531 BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408532 BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408533 BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410728 BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429763 BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408531 Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1 100 ug
$436.00
LY408532 Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4 100 ug
$436.00
LY408533 Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 3 100 ug
$436.00
LY410728 Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 2 100 ug
$436.00
TP306404 Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1, 20 µg 20 ug
$737.00
TP315213 Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.