Bcl G (BCL2L14) (NM_138722) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206404] |
Predicted MW | 36.6 kDa |
Protein Sequence |
Protein Sequence
>RC206404 protein sequence
Red=Cloning site Green=Tags(s) MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_620048 |
RefSeq Size | 1886 |
RefSeq ORF | 981 |
Synonyms | BCLG |
Locus ID | 79370 |
UniProt ID | Q9BZR8 |
Cytogenetics | 12p13.2 |
Summary | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH315213 | BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620049) | 10 ug |
$3,255.00
|
|
LC408531 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408532 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408533 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC410728 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429763 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408531 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1 | 100 ug |
$436.00
|
|
LY408532 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4 | 100 ug |
$436.00
|
|
LY408533 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 3 | 100 ug |
$436.00
|
|
LY410728 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 2 | 100 ug |
$436.00
|
|
TP306404 | Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP315213 | Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.