SHC4 (NM_203349) Human Mass Spec Standard

SKU
PH306373
SHC4 MS Standard C13 and N15-labeled recombinant protein (NP_976224)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206373]
Predicted MW 68.7 kDa
Protein Sequence
Protein Sequence
>RC206373 protein sequence
Red=Cloning site Green=Tags(s)

MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGDKGSPQPPHPALAPHLPTE
DATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRS
GTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCVEVLQSMRSLD
FGMRTQVTREAISRLCEAVPGANGAIKKRKPPVEFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQ
IIANHHMQSISFASGGDPDTTDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPS
LNTSCESEEVHIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRGTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGNQRSAQPLGSP
WHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVL
SGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSLPIISSGSEVSLKQPVRKDNNPALLHSNK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_976224
RefSeq Size 4556
RefSeq ORF 1890
Synonyms RaLP; SHCD
Locus ID 399694
UniProt ID Q6S5L8
Cytogenetics 15q21.1
Summary Activates both Ras-dependent and Ras-independent migratory pathways in melanomas. Contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.[UniProtKB/Swiss-Prot Function]
Protein Pathways Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Focal adhesion, Glioma, Insulin signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway
Write Your Own Review
You're reviewing:SHC4 (NM_203349) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403713 SHC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403713 Transient overexpression lysate of SHC (Src homology 2 domain containing) family, member 4 (SHC4) 100 ug
$436.00
TP306373 Recombinant protein of human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.