OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PBP (PEBP1) (NM_002567) Human Mass Spec Standard

Be the first to review this product
SKU
PH306355
PEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002558)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501616 Anti-PEBP1 (PBP) mouse monoclonal antibody, clone OTI2D4 (formerly 2D4) 100 ul
$447.00
LY400913 Transient overexpression lysate of phosphatidylethanolamine binding protein 1 (PEBP1) (as WB positive control) 100 ug
$436.00

Other products for "PBP or NM_002567"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206355
Predicted MW 21.1 kDa
Protein Sequence
Protein Sequence
>RC206355 protein sequence
Red=Cloning site Green=Tags(s)

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTD
PDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSN
RSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002558
RefSeq Size 1507
RefSeq ORF 561
Synonyms HCNP; HCNPpp; HEL-210; HEL-S-34; HEL-S-96; PBP; PEBP; PEBP-1; RKIP
Locus ID 5037
UniProt ID P30086
Cytogenetics 12q24.23
Summary This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome. provided by RefSeq, Jul 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PBP" proteins (3)
SKU Description Size Price
LC400913 Lyophilized PEBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400913 Transient overexpression lysate of phosphatidylethanolamine binding protein 1 (PEBP1) (as WB positive control) 100 ug
$436.00
TP306355 Recombinant protein of human phosphatidylethanolamine binding protein 1 (PEBP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products