MOB4A (MOB1B) (NM_173468) Human Mass Spec Standard

SKU
PH306337
MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206337]
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC206337 protein sequence
Red=Cloning site Green=Tags(s)

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM
LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
LTSKDR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775739
RefSeq Size 6979
RefSeq ORF 648
Synonyms MATS2; MOB4A; MOBKL1A
Locus ID 92597
UniProt ID Q7L9L4
Cytogenetics 4q13.3
Summary The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Write Your Own Review
You're reviewing:MOB4A (MOB1B) (NM_173468) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406621 MOB1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406621 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A) 100 ug
$436.00
TP306337 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.