RHOBTB1 (NM_014836) Human Mass Spec Standard

SKU
PH306310
RHOBTB1 MS Standard C13 and N15-labeled recombinant protein (NP_055651)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206310]
Predicted MW 79.4 kDa
Protein Sequence
Protein Sequence
>RC206310 protein sequence
Red=Cloning site Green=Tags(s)

MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSR
DVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGC
QLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVFDNAIRAALIS
RRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFA
HRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSN
KSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYT
GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLSKGTFSDVTFK
LDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVLDYLYTKQLSPNLDLDPLELI
ALANRFCLPHLVALAEQHAVQELTKAATSGVGIDGEVLSYLELAQFHNAHQLAAWCLHHICTNYNSVCSK
FRKEIKSKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWNSSPAVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055651
RefSeq Size 4515
RefSeq ORF 2088
Locus ID 9886
UniProt ID O94844
Cytogenetics 10q21.2
Summary The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:RHOBTB1 (NM_014836) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404953 RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414991 RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422316 RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404953 Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 2 100 ug
$665.00
LY414991 Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1 100 ug
$436.00
LY422316 Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3 100 ug
$665.00
TP306310 Recombinant protein of human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1, 20 µg 20 ug
$867.00
TP761967 Purified recombinant protein of Human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.