OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RHOBTB1 (NM_014836) Human Mass Spec Standard

Be the first to review this product
SKU
PH306310
RHOBTB1 MS Standard C13 and N15-labeled recombinant protein (NP_055651)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346261 Rabbit Polyclonal Anti-RHOBTB1 Antibody
100 ul
$585.00
LY404953 Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "RHOBTB1 or NM_014836"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206310
Predicted MW 79.4 kDa
Protein Sequence
Protein Sequence
>RC206310 protein sequence
Red=Cloning site Green=Tags(s)

MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSR
DVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGC
QLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVFDNAIRAALIS
RRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFA
HRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSN
KSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYT
GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLSKGTFSDVTFK
LDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVLDYLYTKQLSPNLDLDPLELI
ALANRFCLPHLVALAEQHAVQELTKAATSGVGIDGEVLSYLELAQFHNAHQLAAWCLHHICTNYNSVCSK
FRKEIKSKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWNSSPAVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055651
RefSeq Size 4515
RefSeq ORF 2088
Locus ID 9886
UniProt ID O94844
Cytogenetics 10q21.2
Summary The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate splicing results in multiple transcript variants. provided by RefSeq, Dec 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RHOBTB1" proteins (8)
SKU Description Size Price
LC404953 Lyophilized RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414991 Lyophilized RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422316 Lyophilized RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404953 Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY414991 Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422316 Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP306310 Recombinant protein of human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1, 20 µg 20 ug
$867.00
TP761967 Purified recombinant protein of Human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products