EIF5 (NM_001969) Human Mass Spec Standard

SKU
PH306301
EIF5 MS Standard C13 and N15-labeled recombinant protein (NP_001960)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206301]
Predicted MW 49.2 kDa
Protein Sequence
Protein Sequence
>RC206301 protein sequence
Red=Cloning site Green=Tags(s)

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF
ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE
AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL
TEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV
IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD
NKDDDIDIDAI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001960
RefSeq Size 5963
RefSeq ORF 1293
Synonyms EIF-5; EIF-5A
Locus ID 1983
UniProt ID P55010
Cytogenetics 14q32.32
Summary Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]).[supplied by OMIM, May 2010]
Write Your Own Review
You're reviewing:EIF5 (NM_001969) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405302 EIF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419615 EIF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405302 Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 2 100 ug
$436.00
LY419615 Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 1 100 ug
$436.00
TP306301 Recombinant protein of human eukaryotic translation initiation factor 5 (EIF5), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.