EIF5 (NM_001969) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206301] |
Predicted MW | 49.2 kDa |
Protein Sequence |
Protein Sequence
>RC206301 protein sequence
Red=Cloning site Green=Tags(s) MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL TEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD NKDDDIDIDAI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001960 |
RefSeq Size | 5963 |
RefSeq ORF | 1293 |
Synonyms | EIF-5; EIF-5A |
Locus ID | 1983 |
UniProt ID | P55010 |
Cytogenetics | 14q32.32 |
Summary | Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]).[supplied by OMIM, May 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC405302 | EIF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419615 | EIF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405302 | Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 2 | 100 ug |
$436.00
|
|
LY419615 | Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 1 | 100 ug |
$436.00
|
|
TP306301 | Recombinant protein of human eukaryotic translation initiation factor 5 (EIF5), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.