Ceramide glucosyltransferase (UGCG) (NM_003358) Human Mass Spec Standard

SKU
PH306288
UGCG MS Standard C13 and N15-labeled recombinant protein (NP_003349)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206288]
Predicted MW 44.9 kDa
Protein Sequence
Protein Sequence
>RC206288 protein sequence
Red=Cloning site Green=Tags(s)

MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL
ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI
WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG
MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR
INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA
VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003349
RefSeq Size 1637
RefSeq ORF 1182
Synonyms GCS; GLCT1
Locus ID 7357
UniProt ID Q16739
Cytogenetics 9q31.3
Summary This gene encodes an enzyme that catalyzes the first glycosylation step in the biosynthesis of glycosphingolipids, which are membrane components containing lipid and sugar moieties. The product of this reaction is glucosylceramide, which is the core structure of many glycosphingolipids. [provided by RefSeq, Dec 2014]
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism
Write Your Own Review
You're reviewing:Ceramide glucosyltransferase (UGCG) (NM_003358) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401148 UGCG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401148 Transient overexpression lysate of UDP-glucose ceramide glucosyltransferase (UGCG) 100 ug
$436.00
TP306288 Recombinant protein of human UDP-glucose ceramide glucosyltransferase (UGCG), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.