COX6B2 (NM_144613) Human Mass Spec Standard

SKU
PH306224
COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206224]
Predicted MW 10.5 kDa
Protein Sequence
Protein Sequence
>RC206224 protein sequence
Red=Cloning site Green=Tags(s)

MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS
WVESWNEQIKNGIFAGKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653214
RefSeq Size 1679
RefSeq ORF 264
Synonyms COXVIB2; CT59
Locus ID 125965
UniProt ID Q6YFQ2
Cytogenetics 19q13.42
Summary Connects the two COX monomers into the physiological dimeric form.[UniProtKB/Swiss-Prot Function]
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Write Your Own Review
You're reviewing:COX6B2 (NM_144613) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408248 COX6B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408248 Transient overexpression lysate of cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2) 100 ug
$436.00
TP306224 Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.