OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COX6B2 (NM_144613) Human Mass Spec Standard

Be the first to review this product
SKU
PH306224
COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501377 COX6B2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5) 100 ul
$447.00
LY408248 Transient overexpression lysate of cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2) (as WB positive control) 100 ug
$436.00

Other products for "COX6B2 or NM_144613"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206224
Predicted MW 10.5 kDa
Protein Sequence
Protein Sequence
>RC206224 protein sequence
Red=Cloning site Green=Tags(s)

MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS
WVESWNEQIKNGIFAGKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653214
RefSeq Size 1679
RefSeq ORF 264
Synonyms COXVIB2; CT59
Locus ID 125965
UniProt ID Q6YFQ2
Cytogenetics 19q13.42
Summary Connects the two COX monomers into the physiological dimeric form.UniProtKB/Swiss-Prot Function
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COX6B2" proteins (3)
SKU Description Size Price
LC408248 Lyophilized COX6B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408248 Transient overexpression lysate of cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2) (as WB positive control) 100 ug
$436.00
TP306224 Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products