HMGCLL1 (NM_001042406) Human Mass Spec Standard

SKU
PH306162
HMGCLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001035865)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206162]
Predicted MW 36.3 kDa
Protein Sequence
Protein Sequence
>RC206162 protein sequence
Red=Cloning site Green=Tags(s)

MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIVEVGPRDGLQNEKVIVPTDI
KIEFINRLSQTGLSVIEVTSFVSSRWVPQMADHTEVMKGIHQYPGVRYPVLTPNLQGFHHAVAAGATEIS
VFGAASESFSKKNINCSIEESMGKFEEVVKSARHMNIPARGYVSCALGCPYEGSITPQKVTEVSKRLYGM
GCYEISLGDTIGVGTPGSMKRMLESVMKEIPPGALAVHCHDTYGQALANILTALQMGINVVDSAVSGLGG
CPYAKGASGNVATEDLIYMLNGLGLNTGVNLYKVMEAGDFICKAVNKTTNSKVAQASFNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035865
RefSeq Size 2481
RefSeq ORF 1020
Synonyms bA418P12.1; er-cHL
Locus ID 54511
UniProt ID Q8TB92
Cytogenetics 6p12.1
Summary Non-mitochondrial 3-hydroxymethyl-3-methylglutaryl-CoA lyase that catalyzes a cation-dependent cleavage of (S)-3-hydroxy-3-methylglutaryl-CoA into acetyl-CoA and acetoacetate, a key step in ketogenesis, the products of which support energy production in nonhepatic animal tissues.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HMGCLL1 (NM_001042406) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420884 HMGCLL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420884 Transient overexpression lysate of 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1 (HMGCLL1), transcript variant 2 100 ug
$436.00
TP306162 Recombinant protein of human 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1 (HMGCLL1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.