OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCAP2 (SKAP2) (NM_003930) Human Mass Spec Standard

Be the first to review this product
SKU
PH306119
SKAP2 MS Standard C13 and N15-labeled recombinant protein (NP_003921)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308273 Rabbit Polyclonal antibody to SCAP2 (src kinase associated phosphoprotein 2)
100 ul
$665.00
LY401289 Transient overexpression lysate of src kinase associated phosphoprotein 2 (SKAP2) (as WB positive control) 100 ug
$436.00

Other products for "SCAP2 or NM_003930"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206119
Predicted MW 41.2 kDa
Protein Sequence
Protein Sequence
>RC206119 protein sequence
Red=Cloning site Green=Tags(s)

MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAE
DGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKR
WCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEW
VQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQR
KMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPK
AYIMEMYDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003921
RefSeq Size 3984
RefSeq ORF 1077
Synonyms PRAP; RA70; SAPS; SCAP2; SKAP-HOM; SKAP55R
Locus ID 8935
UniProt ID O75563
Cytogenetics 7p15.2
Summary The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating proper activation of the immune system. This protein contains an amino terminal coiled-coil domain for self-dimerization, a plecskstrin homology (PH) domain required for interactions with lipids at the membrane, and a Src homology (SH3) domain at the carboxy terminus. Some reports indicate that this protein inhibits actin polymerization through interactions with actin assembly factors, and might negatively regulate the invasiveness of tumors by modulating actin assembly. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jan 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCAP2" proteins (3)
SKU Description Size Price
LC401289 Lyophilized SKAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401289 Transient overexpression lysate of src kinase associated phosphoprotein 2 (SKAP2) (as WB positive control) 100 ug
$436.00
TP306119 Recombinant protein of human src kinase associated phosphoprotein 2 (SKAP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products