CDC2L6 (CDK19) (NM_015076) Human Mass Spec Standard

SKU
PH306105
CDK19 MS Standard C13 and N15-labeled recombinant protein (NP_055891)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206105]
Predicted MW 56.8 kDa
Protein Sequence
Protein Sequence
>RC206105 protein sequence
Red=Cloning site Green=Tags(s)

MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALL
RELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIH
YLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARH
YTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQ
KDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQ
IPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTG
AGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQS
SQYHPSHQAHRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055891
RefSeq Size 6246
RefSeq ORF 1506
Synonyms bA346C16.3; CDC2L6; CDK11; DEE87; EIEE87
Locus ID 23097
UniProt ID Q9BWU1
Cytogenetics 6q21
Summary This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2014]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:CDC2L6 (CDK19) (NM_015076) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414814 CDK19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414814 Transient overexpression lysate of cyclin-dependent kinase 19 (CDK19) 100 ug
$436.00
TP306105 Recombinant protein of human cell division cycle 2-like 6 (CDK8-like) (CDC2L6), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.