RASSF8 (NM_007211) Human Mass Spec Standard

SKU
PH306104
RASSF8 MS Standard C13 and N15-labeled recombinant protein (NP_009142)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206104]
Predicted MW 45.4 kDa
Protein Sequence
Protein Sequence
>RC206104 protein sequence
Red=Cloning site Green=Tags(s)

MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYA
SDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAKGLM
DIFGKGKETEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLE
QKIKRNDVEIEEEEFWENELQIEQENEKQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQRE
VQEAQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQ
QFIQQTGTKVTVLPAEPIEIEASHADIERGIIILSDKQECKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009142
RefSeq Size 2333
RefSeq ORF 1176
Synonyms C12orf2; HOJ1
Locus ID 11228
UniProt ID Q8NHQ8
Cytogenetics 12p12.1
Summary This gene encodes a member of the Ras-assocation domain family (RASSF) of tumor suppressor proteins. This gene is essential for maintaining adherens junction function in epithelial cells and has a role in epithelial cell migration. It is a lung tumor suppressor gene candidate. A chromosomal translocation t(12;22)(p11.2;q13.3) leading to the fusion of this gene and the FBLN1 gene is found in a complex type of synpolydactyly. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
Write Your Own Review
You're reviewing:RASSF8 (NM_007211) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402108 RASSF8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431359 RASSF8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402108 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 (RASSF8), transcript variant 4 100 ug
$436.00
LY431359 Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 (RASSF8), transcript variant 1 100 ug
$436.00
TP306104 Recombinant protein of human Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 (RASSF8), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.