RO60 (NM_001042370) Human Mass Spec Standard

SKU
PH306071
TROVE2 MS Standard C13 and N15-labeled recombinant protein (NP_001035829)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206071]
Predicted MW 60.7 kDa
Protein Sequence
Protein Sequence
>RC206071 protein sequence
Red=Cloning site Green=Tags(s)

MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRG
CEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMK
CGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVH
ELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTA
LLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEIL
KALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKM
DIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035829
RefSeq Size 2091
RefSeq ORF 1614
Synonyms RORNP; SSA2; TROVE2
Locus ID 6738
UniProt ID P10155
Cytogenetics 1q31.2
Summary RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation (PubMed:18056422). Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes (PubMed:26382853).[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Protein Pathways Systemic lupus erythematosus
Write Your Own Review
You're reviewing:RO60 (NM_001042370) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417882 TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420859 TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429213 TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433215 TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417882 Transient overexpression lysate of TROVE domain family, member 2 (TROVE2), transcript variant 2 100 ug
$665.00
LY420859 Transient overexpression lysate of TROVE domain family, member 2 (TROVE2), transcript variant 3 100 ug
$436.00
LY433215 Transient overexpression lysate of TROVE domain family, member 2 (TROVE2), transcript variant 4 100 ug
$436.00
TP306071 Recombinant protein of human TROVE domain family, member 2 (TROVE2), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.