Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Mass Spec Standard

SKU PH306067

CDO1 MS Standard C13 and N15-labeled recombinant protein (NP_001792)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC206067]
• Predicted MW: 23 kDa
• Protein Sequence:
  Protein Sequence

  >RC206067 protein sequence; Red=Cloning site Green=Tags(s); ; MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF; NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLH; RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001792
• RefSeq Size: 1627
• RefSeq ORF: 600
• Synonyms: CDO-I
• Locus ID: 1036
• UniProt ID: Q16878
• Cytogenetics: 5q22.3
• Summary: Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways, Taurine and hypotaurine metabolism