Cyclophilin 40 (PPID) (NM_005038) Human Mass Spec Standard

SKU
PH306039
PPID MS Standard C13 and N15-labeled recombinant protein (NP_005029)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206039]
Predicted MW 40.8 kDa
Protein Sequence
Protein Sequence
>RC206039 protein sequence
Red=Cloning site Green=Tags(s)

MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG
CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP
HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD
IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG
ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV
KQKIKAQKDKEKAVYAKMFA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005029
RefSeq Size 1851
RefSeq ORF 1110
Synonyms CYP-40; CYPD
Locus ID 5481
UniProt ID Q08752
Cytogenetics 4q32.1
Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]
Protein Families Stem cell - Pluripotency
Protein Pathways Calcium signaling pathway, Huntington's disease, Parkinson's disease
Write Your Own Review
You're reviewing:Cyclophilin 40 (PPID) (NM_005038) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401561 PPID HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401561 Transient overexpression lysate of peptidylprolyl isomerase D (PPID) 100 ug
$436.00
TP306039 Recombinant protein of human peptidylprolyl isomerase D (PPID), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720861 Purified recombinant protein of Human peptidylprolyl isomerase D (PPID) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.