KTEL1 (POGLUT1) (NM_152305) Human Mass Spec Standard

SKU
PH305992
KTELC1 MS Standard C13 and N15-labeled recombinant protein (NP_689518)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205992]
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC205992 protein sequence
Red=Cloning site Green=Tags(s)

MEWWASSPLRLWLLLFLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRG
GISRRMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFILEVIGRLPDMEMVINVRDYPQVPKW
MEPAIPVFSFSKTSEYHDIMYPAWTFWEGGPAVWPIYPTGLGRWDLFREDLVRSAAQWPWKKKNSTAYFR
GSRTSPERDPLILLSRKNTKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLVDHCKYKYLFNFRGVAASFRF
KHLFLCGSLVFHVGDEWLEFFYPQLKPWVHYIPVKTDLSNVQELLQFVKANDDVAQEIAERGSQFIRNHL
QMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689518
RefSeq Size 3552
RefSeq ORF 1176
Synonyms C3orf9; CLP46; hCLP46; KDELCL1; KTELC1; LGMD2Z; LGMDR21; MDS010; MDSRP; Rumi
Locus ID 56983
UniProt ID Q8NBL1
Cytogenetics 3q13.33
Summary This gene encodes a protein with both O-glucosyltransferase and O-xylosyltransferase activity which localizes to the lumen of the endoplasmic reticulum. This protein has a carboxy-terminal KTEL motif which is predicted to function as an endoplasmic reticulum retention signal. This gene is an essential regulator of Notch signalling and likely plays a role in cell fate and tissue formation during development. It may also play a role in the pathogenesis of leukemia. Mutations in this gene have been associated with the autosomal dominant genodermatosis Dowling-Degos disease 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Write Your Own Review
You're reviewing:KTEL1 (POGLUT1) (NM_152305) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407662 POGLUT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407662 Transient overexpression lysate of KTEL (Lys-Tyr-Glu-Leu) containing 1 (KTELC1), transcript variant 1 100 ug
$436.00
TP305992 Recombinant protein of human KTEL (Lys-Tyr-Glu-Leu) containing 1 (KTELC1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.