GFM2 (NM_032380) Human Mass Spec Standard

SKU
PH305962
GFM2 MS Standard C13 and N15-labeled recombinant protein (NP_115756)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205962]
Predicted MW 86.2 kDa
Protein Sequence
Protein Sequence
>RC205962 protein sequence
Red=Cloning site Green=Tags(s)

MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSIHSIINPPIAKI
RNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYRVNLI
DTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRICFLNKMDKTGASFKYAVES
IREKLKAKPLLLQLPIGEAKTFKGVVDVVMKEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNAL
IEQVADLDDEFADLVLEEFSENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLP
SPEERNYEFLQWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQ
HVEIHSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEIPEPVF
FCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPL
QVAYRETILNSVRATDTLDRTLGDKRHLVTVEVGARPIETSSVMPVIEYAESINEGLLKVSQEAIENGIH
SACLQGPLLGSPIQDVAITLHSLTIHPGTSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLS
PVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAGIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNTLL
NRRSGLT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115756
RefSeq Size 3264
RefSeq ORF 2331
Synonyms EF-G2mt; EFG2; hEFG2; mEF-G 2; MRRF2; MST027; MSTP027; RRF; RRF2; RRF2mt
Locus ID 84340
UniProt ID Q969S9
Cytogenetics 5q13.3
Summary Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors, which is a GTPase that plays a role at the termination of mitochondrial translation by mediating the disassembly of ribosomes from messenger RNA . Its role in the regulation of normal mitochondrial function and in disease states attributed to mitochondrial dysfunction is not known. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:GFM2 (NM_032380) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406908 GFM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410173 GFM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406908 Transient overexpression lysate of G elongation factor, mitochondrial 2 (GFM2), nuclear gene encoding mitochondrial protein, transcript variant 3 100 ug
$665.00
LY410173 Transient overexpression lysate of G elongation factor, mitochondrial 2 (GFM2), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
TP305962 Recombinant protein of human G elongation factor, mitochondrial 2 (GFM2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.