ATG4C (NM_178221) Human Mass Spec Standard

SKU
PH305955
ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_835739)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205955]
Predicted MW 52.3 kDa
Protein Sequence
Protein Sequence
>RC205955 representing NM_178221
Red=Cloning site Green=Tags(s)

MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDH
VIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALN
IENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLA
LFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMT
SDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ
SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN
GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_835739
RefSeq Size 1774
RefSeq ORF 1374
Synonyms APG4-C; APG4C; AUTL1; AUTL3
Locus ID 84938
UniProt ID Q96DT6
Cytogenetics 1p31.3
Summary Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]
Protein Families Protease
Protein Pathways Regulation of autophagy
Write Your Own Review
You're reviewing:ATG4C (NM_178221) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316088 ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_116241) 10 ug
$3,255.00
LC403599 ATG4C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409886 ATG4C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403599 Transient overexpression lysate of ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8 100 ug
$436.00
LY409886 Transient overexpression lysate of ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 7 100 ug
$436.00
TP305955 Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316088 Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 7, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.