FATE1 (NM_033085) Human Mass Spec Standard

SKU PH305951

FATE1 MS Standard C13 and N15-labeled recombinant protein (NP_149076)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205951]
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC205951 protein sequence; Red=Cloning site Green=Tags(s); ; MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM; TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ; LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_149076
• RefSeq Size: 1071
• RefSeq ORF: 549
• Synonyms: CT43; FATE
• Locus ID: 89885
• UniProt ID: Q969F0
• Cytogenetics: Xq28
• Summary: This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010]
• Protein Families: Transmembrane