SMYD3 (NM_022743) Human Mass Spec Standard

SKU
PH305933
SMYD3 MS Standard C13 and N15-labeled recombinant protein (NP_073580)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205933]
Predicted MW 49.1 kDa
Protein Sequence
Protein Sequence
>RC205933 protein sequence
Red=Cloning site Green=Tags(s)

MEPLKVEKFATANRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKY
CSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDR
KEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDP
NCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDE
QVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFY
GTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEE
CDANIRAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073580
RefSeq Size 1469
RefSeq ORF 1284
Synonyms bA74P14.1; KMT3E; ZMYND1; ZNFN3A1
Locus ID 64754
UniProt ID Q9H7B4
Cytogenetics 1q44
Summary This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Write Your Own Review
You're reviewing:SMYD3 (NM_022743) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402935 SMYD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402935 Transient overexpression lysate of SET and MYND domain containing 3 (SMYD3), transcript variant 2 100 ug
$436.00
TP305933 Recombinant protein of human SET and MYND domain containing 3 (SMYD3), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.