MTP18 (MTFP1) (NM_016498) Human Mass Spec Standard

SKU
PH305922
MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205922]
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC205922 protein sequence
Red=Cloning site Green=Tags(s)

MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE
AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP
IDRSVDFLLDSSLRKLYPTVGKPSSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057582
RefSeq Size 1298
RefSeq ORF 498
Synonyms HSPC242; MTP18
Locus ID 51537
UniProt ID Q9UDX5
Cytogenetics 22q12.2
Summary MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:MTP18 (MTFP1) (NM_016498) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423990 MTFP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423990 Transient overexpression lysate of mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
TP305922 Purified recombinant protein of Homo sapiens mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.