Neurofilament (NEFL) (NM_006158) Human Mass Spec Standard

SKU
PH305920
NEFL MS Standard C13 and N15-labeled recombinant protein (NP_006149)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205920]
Predicted MW 61.5 kDa
Protein Sequence
Protein Sequence
>RC205920 protein sequence
Red=Cloning site Green=Tags(s)

MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLEN
LDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYE
QEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELE
KRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWF
KSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDT
INKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEE
AAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006149
RefSeq Size 3854
RefSeq ORF 1629
Synonyms CMT1F; CMT2E; CMTDIG; NF-L; NF68; NFL; PPP1R110
Locus ID 4747
UniProt ID P07196
Cytogenetics 8p21.2
Summary Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Amyotrophic lateral sclerosis (ALS)
Write Your Own Review
You're reviewing:Neurofilament (NEFL) (NM_006158) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416829 NEFL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416829 Transient overexpression lysate of neurofilament, light polypeptide (NEFL) 100 ug
$436.00
TP305920 Recombinant protein of human neurofilament, light polypeptide (NEFL), 20 µg 20 ug
$867.00
TP762354 Purified recombinant protein of Human neurofilament, light polypeptide (NEFL), Met1-Thr360, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762419 Purified recombinant protein of Human neurofilament, light polypeptide (NEFL), Ser2-Glu90, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762429 Purified recombinant protein of Human neurofilament, light polypeptide (NEFL), Glu90-Leu400, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.