Neurofilament (NEFL) (NM_006158) Human Mass Spec Standard
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC205920] |
Predicted MW | 61.5 kDa |
Protein Sequence |
Protein Sequence
>RC205920 protein sequence
Red=Cloning site Green=Tags(s) MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLEN LDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYE QEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELE KRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWF KSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDT INKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEE AAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006149 |
RefSeq Size | 3854 |
RefSeq ORF | 1629 |
Synonyms | CMT1F; CMT2E; CMTDIG; NF-L; NF68; NFL; PPP1R110 |
Locus ID | 4747 |
UniProt ID | P07196 |
Cytogenetics | 8p21.2 |
Summary | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Amyotrophic lateral sclerosis (ALS) |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC416829 | NEFL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416829 | Transient overexpression lysate of neurofilament, light polypeptide (NEFL) | 100 ug |
$436.00
|
|
TP305920 | Recombinant protein of human neurofilament, light polypeptide (NEFL), 20 µg | 20 ug |
$867.00
|
|
TP762354 | Purified recombinant protein of Human neurofilament, light polypeptide (NEFL), Met1-Thr360, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
TP762419 | Purified recombinant protein of Human neurofilament, light polypeptide (NEFL), Ser2-Glu90, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
TP762429 | Purified recombinant protein of Human neurofilament, light polypeptide (NEFL), Glu90-Leu400, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$226.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.