TRF1 (TERF1) (NM_003218) Human Mass Spec Standard

SKU
PH305904
TERF1 MS Standard C13 and N15-labeled recombinant protein (NP_003209)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205904]
Predicted MW 48.2 kDa
Protein Sequence
Protein Sequence
>RC205904 protein sequence
Red=Cloning site Green=Tags(s)

MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEA
EAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDA
QFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPF
KSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSG
NDVEMETEANLDTRKRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPV
TPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003209
RefSeq Size 2900
RefSeq ORF 1257
Synonyms hTRF1-AS; PIN2; t-TRF1; TRBF1; TRF; TRF1
Locus ID 7013
UniProt ID P54274
Cytogenetics 8q21.11
Summary This gene encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of individual chromosome ends. The protein structure contains a C-terminal Myb motif, a dimerization domain near its N-terminus and an acidic N-terminus. Two transcripts of this gene are alternatively spliced products. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:TRF1 (TERF1) (NM_003218) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413770 TERF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418833 TERF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413770 Transient overexpression lysate of telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 1 100 ug
$665.00
LY418833 Transient overexpression lysate of telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 2 100 ug
$436.00
TP305904 Recombinant protein of human telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.