GNGT1 (NM_021955) Human Mass Spec Standard

SKU PH305899

GNGT1 MS Standard C13 and N15-labeled recombinant protein (NP_068774)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205899]
• Predicted MW: 8.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC205899 protein sequence; Red=Cloning site Green=Tags(s); ; MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG; CVIS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_068774
• RefSeq Size: 628
• RefSeq ORF: 222
• Synonyms: GNG1
• Locus ID: 2792
• UniProt ID: P63211
• Cytogenetics: 7q21.3
• Summary: This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway