GNGT1 (NM_021955) Human Mass Spec Standard
GNGT1 MS Standard C13 and N15-labeled recombinant protein (NP_068774)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205899 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC205899 protein sequence
Red=Cloning site Green=Tags(s) MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG CVIS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_068774 |
RefSeq Size | 628 |
RefSeq ORF | 222 |
Synonyms | GNG1 |
Locus ID | 2792 |
UniProt ID | P63211 |
Cytogenetics | 7q21.3 |
Summary | This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP305899 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1) |
USD 823.00 |
USD 275.00