RBP5 (NM_031491) Human Mass Spec Standard

SKU
PH305891
RBP5 MS Standard C13 and N15-labeled recombinant protein (NP_113679)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205891]
Predicted MW 15.9 kDa
Protein Sequence
Protein Sequence
>RC205891 protein sequence
Red=Cloning site Green=Tags(s)

MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVE
FEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_113679
RefSeq Size 968
RefSeq ORF 405
Synonyms CRBP-III; CRBP3; CRBPIII; HRBPiso
Locus ID 83758
UniProt ID P82980
Cytogenetics 12p13.31
Summary The protein encoded by this gene is a cellular retinol-binding protein expressed highly in kidney and liver. Down-regulation of the encoded protein in hepatocellular carcinoma was associated with large tumor size and poor patient survival rates. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:RBP5 (NM_031491) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410487 RBP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410487 Transient overexpression lysate of retinol binding protein 5, cellular (RBP5) 100 ug
$436.00
TP305891 Recombinant protein of human retinol binding protein 5, cellular (RBP5), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.