CEBP Beta (CEBPB) (NM_005194) Human Mass Spec Standard

SKU
PH305882
CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205882]
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC205882 representing NM_005194
Red=Cloning site Green=Tags(s)

MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE
RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV
SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY
LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER
NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005185
RefSeq Size 1837
RefSeq ORF 1035
Synonyms C/EBP-beta; IL6DBP; NF-IL6; TCF5
Locus ID 1051
UniProt ID P17676
Cytogenetics 20q13.13
Summary This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Write Your Own Review
You're reviewing:CEBP Beta (CEBPB) (NM_005194) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417451 CEBPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417451 Transient overexpression lysate of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) 100 ug
$436.00
TP305882 Recombinant protein of human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.