SNX8 (NM_013321) Human Mass Spec Standard

SKU
PH305847
SNX8 MS Standard C13 and N15-labeled recombinant protein (NP_037453)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205847]
Predicted MW 52.6 kDa
Protein Sequence
Protein Sequence
>RC205847 protein sequence
Red=Cloning site Green=Tags(s)

MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQE
LLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGA
DREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFL
PADIQAQFAISRELIRNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSST
WGSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYS
LMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN
SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037453
RefSeq Size 4756
RefSeq ORF 1395
Synonyms Mvp1
Locus ID 29886
UniProt ID Q9Y5X2
Cytogenetics 7p22.3
Summary May be involved in several stages of intracellular trafficking. May play a role in intracellular protein transport from early endosomes to the trans-Golgi network.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SNX8 (NM_013321) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402251 SNX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402251 Transient overexpression lysate of sorting nexin 8 (SNX8) 100 ug
$436.00
TP305847 Recombinant protein of human sorting nexin 8 (SNX8), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.