splicing factor 1 (SF1) (NM_201998) Human Mass Spec Standard

SKU
PH305846
SF1 MS Standard C13 and N15-labeled recombinant protein (NP_973727)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205846]
Predicted MW 59.7 kDa
Protein Sequence
Protein Sequence
>RC205846 protein sequence
Red=Cloning site Green=Tags(s)

MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL
GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKV
MIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTAN
TMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCT
KCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA
NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPP
PPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQRSLPAAAMARAMRVRTFRAHW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_973727
RefSeq Size 2949
RefSeq ORF 1644
Synonyms BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162
Locus ID 7536
UniProt ID Q15637
Cytogenetics 11q13.1
Summary This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:splicing factor 1 (SF1) (NM_201998) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404503 SF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404504 SF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404505 SF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417858 SF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404503 Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 2 100 ug
$665.00
LY404504 Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 4 100 ug
$436.00
LY404505 Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 3 100 ug
$436.00
LY417858 Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 1 100 ug
$665.00
TP305846 Recombinant protein of human splicing factor 1 (SF1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.