WSB1 (NM_015626) Human Mass Spec Standard

SKU
PH305839
WSB1 MS Standard C13 and N15-labeled recombinant protein (NP_056441)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205839]
Predicted MW 47.4 kDa
Protein Sequence
Protein Sequence
>RC205839 protein sequence
Red=Cloning site Green=Tags(s)

MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNF
LLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQ
LLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVL
RGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV
YIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP
LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR
I

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056441
RefSeq Size 2849
RefSeq ORF 1263
Synonyms SWIP1; WSB-1
Locus ID 26118
UniProt ID Q9Y6I7
Cytogenetics 17q11.1
Summary This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:WSB1 (NM_015626) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408739 WSB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414461 WSB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408739 Transient overexpression lysate of WD repeat and SOCS box-containing 1 (WSB1), transcript variant 2 100 ug
$436.00
LY414461 Transient overexpression lysate of WD repeat and SOCS box-containing 1 (WSB1), transcript variant 1 100 ug
$436.00
TP305839 Recombinant protein of human WD repeat and SOCS box-containing 1 (WSB1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.