EFHC1 (NM_018100) Human Mass Spec Standard

SKU
PH305830
EFHC1 MS Standard C13 and N15-labeled recombinant protein (NP_060570)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205830]
Predicted MW 73.9 kDa
Protein Sequence
Protein Sequence
>RC205830 protein sequence
Red=Cloning site Green=Tags(s)

MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAP
VLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVEN
SGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALD
PYTELRKQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHE
RNDGIDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPF
TRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL
RYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDF
FIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELE
ALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELLRMCSHGEGKIN
YYNFVRAFSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060570
RefSeq Size 5596
RefSeq ORF 1920
Synonyms dJ304B14.2; EJM1; POC9; RIB72
Locus ID 114327
UniProt ID Q5JVL4
Cytogenetics 6p12.2
Summary This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
Write Your Own Review
You're reviewing:EFHC1 (NM_018100) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413316 EFHC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433359 EFHC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413316 Transient overexpression lysate of EF-hand domain (C-terminal) containing 1 (EFHC1) 100 ug
$436.00
LY433359 Transient overexpression lysate of EF-hand domain (C-terminal) containing 1 (EFHC1), transcript variant C 100 ug
$436.00
TP305830 Recombinant protein of human EF-hand domain (C-terminal) containing 1 (EFHC1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.