PHACS (ACCS) (NM_032592) Human Mass Spec Standard

SKU
PH305806
ACCS MS Standard C13 and N15-labeled recombinant protein (NP_115981)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205806]
Predicted MW 57.3 kDa
Protein Sequence
Protein Sequence
>RC205806 protein sequence
Red=Cloning site Green=Tags(s)

MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMI
KWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQRDMQRVEPSLLQYADWRGHLF
LREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRL
AYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHR
LHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC
RYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYL
LKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRP
SQSQEPSDQRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115981
RefSeq Size 2196
RefSeq ORF 1503
Synonyms ACS; PHACS
Locus ID 84680
UniProt ID Q96QU6
Cytogenetics 11p11.2
Summary Does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PHACS (ACCS) (NM_032592) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325861 ACCS MS Standard C13 and N15-labeled recombinant protein (NP_001120691) 10 ug
$3,255.00
LC410022 ACCS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426720 ACCS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410022 Transient overexpression lysate of 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) (ACCS), transcript variant 1 100 ug
$436.00
LY426720 Transient overexpression lysate of 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) (ACCS), transcript variant 2 100 ug
$436.00
TP305806 Recombinant protein of human 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) (ACCS), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325861 Recombinant protein of human 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) (ACCS), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.