FBLIM1 (NM_017556) Human Mass Spec Standard

SKU
PH305764
FBLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_060026)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205764]
Predicted MW 40.7 kDa
Protein Sequence
Protein Sequence
>RC205764 protein sequence
Red=Cloning site Green=Tags(s)

MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAA
ATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGASLIADLEQLHLSP
PPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGASTDICAFCHKTVFPRELAVEAMKRQYHAQCFT
CRTCRRQLAGQSFYQKDGRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDES
FALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQG
CYPLNNHLFCKPCHVKRSAAGCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060026
RefSeq Size 3363
RefSeq ORF 1119
Synonyms CAL; FBLP-1; FBLP1
Locus ID 54751
UniProt ID Q8WUP2
Cytogenetics 1p36.21
Summary This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FBLIM1 (NM_017556) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311828 FBLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_001019387) 10 ug
$3,255.00
LC402597 FBLIM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422622 FBLIM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422623 FBLIM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402597 Transient overexpression lysate of filamin binding LIM protein 1 (FBLIM1), transcript variant 1 100 ug
$436.00
LY422622 Transient overexpression lysate of filamin binding LIM protein 1 (FBLIM1), transcript variant 2 100 ug
$436.00
LY422623 Transient overexpression lysate of filamin binding LIM protein 1 (FBLIM1), transcript variant 3 100 ug
$436.00
TP305764 Recombinant protein of human filamin binding LIM protein 1 (FBLIM1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311828 Purified recombinant protein of Homo sapiens filamin binding LIM protein 1 (FBLIM1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.