Kindlin 2 (FERMT2) (NM_006832) Human Mass Spec Standard

SKU
PH305727
FERMT2 MS Standard C13 and N15-labeled recombinant protein (NP_006823)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205727]
Predicted MW 77.9 kDa
Protein Sequence
Protein Sequence
>RC205727 protein sequence
Red=Cloning site Green=Tags(s)

MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRT
WLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL
LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGD
SALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFF
DLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAAL
SDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQ
NILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQ
AWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFAD
EVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006823
RefSeq Size 3351
RefSeq ORF 2040
Synonyms KIND2; mig-2; MIG2; PLEKHC1; UNC112; UNC112B
Locus ID 10979
UniProt ID Q96AC1
Cytogenetics 14q22.1
Summary Scaffolding protein that enhances integrin activation mediated by TLN1 and/or TLN2, but activates integrins only weakly by itself. Binds to membranes enriched in phosphoinositides. Enhances integrin-mediated cell adhesion onto the extracellular matrix and cell spreading; this requires both its ability to interact with integrins and with phospholipid membranes. Required for the assembly of focal adhesions. Participates in the connection between extracellular matrix adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits FBLIM1 to focal adhesions. Plays a role in the TGFB1 and integrin signaling pathways. Stabilizes active CTNNB1 and plays a role in the regulation of transcription mediated by CTNNB1 and TCF7L2/TCF4 and in Wnt signaling.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Kindlin 2 (FERMT2) (NM_006832) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416377 FERMT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427519 FERMT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416377 Transient overexpression lysate of fermitin family homolog 2 (Drosophila) (FERMT2), transcript variant 1 100 ug
$436.00
LY427519 Transient overexpression lysate of fermitin family homolog 2 (Drosophila) (FERMT2), transcript variant 2 100 ug
$665.00
TP305727 Recombinant protein of human fermitin family homolog 2 (Drosophila) (FERMT2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.