YJU2 (NM_018074) Human Mass Spec Standard

SKU
PH305711
CCDC94 MS Standard C13 and N15-labeled recombinant protein (NP_060544)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205711]
Predicted MW 37.1 kDa
Protein Sequence
Protein Sequence
>RC205711 protein sequence
Red=Cloning site Green=Tags(s)

MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEVYLG
LPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENR
TKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEEARKRRLLED
SDSEDEAAPSPLQPALRPNPTAILDEAPKPKRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADPDCSNGQP
QAAPTPGAPQNRKEANPTPLTPGASSLSQLGAYLDSDDSNGSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060544
RefSeq Size 1441
RefSeq ORF 969
Synonyms CCDC94
Locus ID 55702
UniProt ID Q9BW85
Cytogenetics 19p13.3
Summary Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA (PubMed:29301961). Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'-intermediates (By similarity). May protect cells from TP53-dependent apoptosis upon dsDNA break damage through association with PRP19-CD5L complex (PubMed:22952453).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:YJU2 (NM_018074) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413333 CCDC94 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413333 Transient overexpression lysate of coiled-coil domain containing 94 (CCDC94) 100 ug
$436.00
TP305711 Recombinant protein of human coiled-coil domain containing 94 (CCDC94), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.