LMAN2 (NM_006816) Human Mass Spec Standard

SKU
PH305704
LMAN2 MS Standard C13 and N15-labeled recombinant protein (NP_006807)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205704]
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC205704 protein sequence
Red=Cloning site Green=Tags(s)

MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSS
SMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRD
RLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRD
HDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEH
TPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQE
RNKRFY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006807
RefSeq Size 1853
RefSeq ORF 1068
Synonyms C5orf8; GP36B; VIP36
Locus ID 10960
UniProt ID Q12907
Cytogenetics 5q35.3
Summary This gene encodes a type I transmembrane lectin that shuttles between the endoplasmic reticulum, the Golgi apparatus and the plasma membrane. The encoded protein binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. [provided by RefSeq, Oct 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LMAN2 (NM_006816) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416403 LMAN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416403 Transient overexpression lysate of lectin, mannose-binding 2 (LMAN2) 100 ug
$436.00
TP305704 Recombinant protein of human lectin, mannose-binding 2 (LMAN2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720717 Purified recombinant protein of Human lectin, mannose-binding 2 (LMAN2) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.