Rab9 (RAB9A) (NM_004251) Human Mass Spec Standard

SKU
PH305698
RAB9A MS Standard C13 and N15-labeled recombinant protein (NP_004242)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205698]
Predicted MW 22.8 kDa
Protein Sequence
Protein Sequence
>RC205698 protein sequence
Red=Cloning site Green=Tags(s)

MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR
SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQA
WCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004242
RefSeq Size 1377
RefSeq ORF 603
Synonyms RAB9
Locus ID 9367
UniProt ID P51151
Cytogenetics Xp22.2
Summary Involved in the transport of proteins between the endosomes and the trans Golgi network. Involved in the recruitment of SGSM2 to melanosomes and is required for the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Rab9 (RAB9A) (NM_004251) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401363 RAB9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401363 Transient overexpression lysate of RAB9A, member RAS oncogene family (RAB9A) 100 ug
$436.00
TP305698 Recombinant protein of human RAB9A, member RAS oncogene family (RAB9A), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.