KIN (NM_012311) Human Mass Spec Standard

SKU
PH305689
KIN MS Standard C13 and N15-labeled recombinant protein (NP_036443)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205689]
Predicted MW 45.4 kDa
Protein Sequence
Protein Sequence
>RC205689 protein sequence
Red=Cloning site Green=Tags(s)

MGKSDFLTPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASENPQQFMDYFSE
EFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQ
YIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKG
ACSSSGATSSKSSTLGPSALKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDYW
LQPEIIVKIITKKLGEKYHKKKAIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGY
RGNEGTLESINEKTFSATIVIETGPLKGRRVEGIQYEDISKLA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036443
RefSeq Size 6401
RefSeq ORF 1179
Synonyms BTCD; KIN17; Rts2
Locus ID 22944
UniProt ID O60870
Cytogenetics 10p14
Summary The protein encoded by this gene is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by this human ortholog. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:KIN (NM_012311) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402191 KIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402191 Transient overexpression lysate of KIN, antigenic determinant of recA protein homolog (mouse) (KIN) 100 ug
$436.00
TP305689 Recombinant protein of human KIN, antigenic determinant of recA protein homolog (mouse) (KIN), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.