ADRM1 (NM_175573) Human Mass Spec Standard

SKU
PH305671
ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_783163)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205671]
Predicted MW 42.2 kDa
Protein Sequence
Protein Sequence
>RC205671 protein sequence
Red=Cloning site Green=Tags(s)

MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE
DDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGAS
GSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSR
SQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGP
AGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASG
QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_783163
RefSeq Size 1492
RefSeq ORF 1221
Synonyms ARM-1; ARM1; GP110; PSMD16
Locus ID 11047
UniProt ID Q16186
Cytogenetics 20q13.33
Summary This gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5. Increased levels of the encoded protein are associated with increased cell adhesion, which is likely an indirect effect of this intracellular protein. Dysregulation of this gene has been implicated in carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:ADRM1 (NM_175573) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315635 ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_008933) 10 ug
$3,255.00
LC402072 ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406279 ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402072 Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 1 100 ug
$436.00
LY406279 Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 2 100 ug
$436.00
TP305671 Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315635 Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.