RPL26L1 (NM_016093) Human Mass Spec Standard

SKU
PH305652
RPL26L1 MS Standard C13 and N15-labeled recombinant protein (NP_057177)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205652]
Predicted MW 17.3 kDa
Protein Sequence
Protein Sequence
>RC205652 protein sequence
Red=Cloning site Green=Tags(s)

MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV
VQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELI
EKMQE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057177
RefSeq Size 723
RefSeq ORF 435
Synonyms RPL26P1
Locus ID 51121
UniProt ID Q9UNX3
Cytogenetics 5q35.1
Summary This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Dec 2015]
Protein Pathways Ribosome
Write Your Own Review
You're reviewing:RPL26L1 (NM_016093) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414197 RPL26L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414197 Transient overexpression lysate of ribosomal protein L26-like 1 (RPL26L1) 100 ug
$436.00
TP305652 Recombinant protein of human ribosomal protein L26-like 1 (RPL26L1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.