TMEM59 (NM_004872) Human Mass Spec Standard

SKU
PH305624
TMEM59 MS Standard C13 and N15-labeled recombinant protein (NP_004863)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205624]
Predicted MW 36.3 kDa
Protein Sequence
Protein Sequence
>RC205624 protein sequence
Red=Cloning site Green=Tags(s)

MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC
QRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHL
LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSSD
LQMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGD
LEFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004863
RefSeq Size 1709
RefSeq ORF 972
Synonyms C1orf8; DCF1; HSPC001; PRO195; UNQ169
Locus ID 9528
UniProt ID Q9BXS4
Cytogenetics 1p32.3
Summary This gene encodes a protein shown to regulate autophagy in response to bacterial infection. This protein may also regulate the retention of amyloid precursor protein (APP) in the Golgi apparatus through its control of APP glycosylation. Overexpression of this protein has been found to promote apoptosis in a glioma cell line. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM59 (NM_004872) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417690 TMEM59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417690 Transient overexpression lysate of transmembrane protein 59 (TMEM59) 100 ug
$436.00
TP305624 Recombinant protein of human transmembrane protein 59 (TMEM59), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.